PDB entry 4k6d

View 4k6d on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant V23M/T62F at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, pdtp, cavity, pressure, HYDROLASE
Deposited on 2013-04-15, released 2013-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-04-24, with a file datestamp of 2013-04-19.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.191
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (22)
      • engineered mutation (61)
    Domains in SCOPe 2.08: d4k6da_
  • Heterogens: THP, CA, MPD, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4k6dA (A:)
atstkklhkepatlikaidgdtmklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ffkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
heqhlrkseaqakkeklniwsednadsgq

    Sequence, based on observed residues (ATOM records): (download) 
    >4k6dA (A:)
klhkepatlikaidgdtmklmykgqpmtfrlllvdtpygpeasaffkkmvenakkievef
dkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlrkseaqakkek
lniws