PDB entry 4k3v

View 4k3v on RCSB PDB site
Description: Structure of Staphylococcus aureus MntC
Class: transport protein
Keywords: Mn2+ specific mntABC transporter, TRANSPORT PROTEIN
Deposited on 2013-04-11, released 2013-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.199
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABC superfamily ATP binding cassette transporter, binding protein
    Species: Staphylococcus aureus [TaxId:869816]
    Gene: mntC, SAA6159_00586
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4k3va_
  • Chain 'B':
    Compound: ABC superfamily ATP binding cassette transporter, binding protein
    Species: Staphylococcus aureus [TaxId:869816]
    Gene: mntC, SAA6159_00586
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4k3vb_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k3vA (A:)
    mkklvplllallllvaacgtggkqssdksngklkvvttnsilydmaknvggdnvdihsiv
    pvgqdpheyevkpkdikkltdadvilynglnletgngwfekaleqagkslkdkkviavsk
    dvkpiylngeegnkdkqdphawlsldngikyvktiqqtfidndkkhkadyekqgnkyiaq
    leklnndskdkfndipkeqramitsegafkyfskqygitpgyiweintekqgtpeqmrqa
    iefvkkhklkhllvetsvdkkameslseetkkdifgevytdsigkegtkgdsyykmmksn
    ietvhgsmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3vA (A:)
    gklkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikkltdadvilyngl
    nletgngwfekaleqagkslkdkkviavskdvkpiylndkqdphawlsldngikyvktiq
    qtfidndkkhkadyekqgnkyiaqleklnndskdkfndipkeqramitsegafkyfskqy
    gitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetgevytdsigkegtkgdsyyk
    mmksnietvhgsm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4k3vB (B:)
    mkklvplllallllvaacgtggkqssdksngklkvvttnsilydmaknvggdnvdihsiv
    pvgqdpheyevkpkdikkltdadvilynglnletgngwfekaleqagkslkdkkviavsk
    dvkpiylngeegnkdkqdphawlsldngikyvktiqqtfidndkkhkadyekqgnkyiaq
    leklnndskdkfndipkeqramitsegafkyfskqygitpgyiweintekqgtpeqmrqa
    iefvkkhklkhllvetsvdkkameslseetkkdifgevytdsigkegtkgdsyykmmksn
    ietvhgsmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3vB (B:)
    gklkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikkltdadvilyngl
    nletgngwfekaleqagkslkdkkviavskdvkpiylngeegnkdkqdphawlsldngik
    yvktiqqtfidndkkhkadyekqgnkyiaqleklnndskdkfndipkeqramitsegafk
    yfskqygitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetsvdkkameslseet
    kkdifgevytdsigkegtkgdsyykmmksnietvhgsm