PDB entry 4k3h

View 4k3h on RCSB PDB site
Description: Immunoglobulin lambda variable domain L5(L89S) fluorogen activationg protein in complex with malachite green
Class: immune system/inhibitor
Keywords: immunoglobulin fold, fluorescensce, malachite green, o-mannosylation, Thr27, immune system-inhibitor complex
Deposited on 2013-04-10, released 2013-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.196
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin lambda variable domain L5(L89S)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3H (0-End)
    Domains in SCOPe 2.07: d4k3ha_
  • Chain 'B':
    Compound: Immunoglobulin lambda variable domain L5(L89S)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3H (0-End)
    Domains in SCOPe 2.07: d4k3hb_
  • Chain 'C':
    Compound: Immunoglobulin lambda variable domain L5(L89S)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3H (0-End)
    Domains in SCOPe 2.07: d4k3hc_
  • Chain 'D':
    Compound: Immunoglobulin lambda variable domain L5(L89S)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3H (0-End)
    Domains in SCOPe 2.07: d4k3hd_
  • Chain 'E':
    Compound: Immunoglobulin lambda variable domain L5(L89S)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3H (0-End)
    Domains in SCOPe 2.07: d4k3he_
  • Chain 'F':
    Compound: Immunoglobulin lambda variable domain L5(L89S)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3H (0-End)
    Domains in SCOPe 2.07: d4k3hf_
  • Chain 'G':
    Compound: Immunoglobulin lambda variable domain L5(L89S)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3H (0-End)
    Domains in SCOPe 2.07: d4k3hg_
  • Chain 'H':
    Compound: Immunoglobulin lambda variable domain L5(L89S)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3H (0-End)
    Domains in SCOPe 2.07: d4k3hh_
  • Heterogens: 1OM, GOL, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k3hA (A:)
    qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
    pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvlstghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3hA (A:)
    qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
    pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4k3hB (B:)
    qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
    pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvlstghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3hB (B:)
    qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
    pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4k3hC (C:)
    qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
    pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvlstghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3hC (C:)
    qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
    pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4k3hD (D:)
    qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
    pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvlstghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3hD (D:)
    qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
    pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4k3hE (E:)
    qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
    pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvlstghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3hE (E:)
    qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
    pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4k3hF (F:)
    qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
    pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvlstghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3hF (F:)
    qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
    pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4k3hG (G:)
    qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
    pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvlstghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3hG (G:)
    qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
    pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4k3hH (H:)
    qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
    pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvlstghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3hH (H:)
    qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
    pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvl