PDB entry 4k3g

View 4k3g on RCSB PDB site
Description: Immunoglobulin lambda variable domain L5(L89S) fluorogen activating protein
Class: immune system
Keywords: immunoglobulin fold, fluorescence, malachite green, o-mannosylation, Thr27, IMMUNE SYSTEM
Deposited on 2013-04-10, released 2013-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.195
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin lambda variable domain L5(L89S)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3G
    Domains in SCOPe 2.07: d4k3ga_
  • Chain 'B':
    Compound: Immunoglobulin lambda variable domain L5(L89S)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3G (0-End)
    Domains in SCOPe 2.07: d4k3gb_
  • Heterogens: MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k3gA (A:)
    qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
    pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvlstghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3gA (A:)
    avvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswtp
    grfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4k3gB (B:)
    qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
    pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvlstghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3gB (B:)
    qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
    pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvl