PDB entry 4k2w

View 4k2w on RCSB PDB site
Description: X-ray crystal structure of superoxide dismutase from Babesia bovis solved by Sulfur/Zinc SAD
Class: oxidoreductase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, Superoxide dismutase, oxidoreductase
Deposited on 2013-04-09, released 2013-05-08
Made obsolete by 4yet on 2015-04-15

The last revision prior to the SCOPe 2.03 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.145
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Babesia bovis [TaxId:5865]
    Gene: Fe-SOD, BBOV_IV011480
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4k2wa1, d4k2wa2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Babesia bovis [TaxId:5865]
    Gene: Fe-SOD, BBOV_IV011480
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15904 (4-202)
      • expression tag (3)
    Domains in SCOPe 2.03: d4k2wb1, d4k2wb2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k2wA (A:)
    gpgsmafklpalpygmreliphiseetlsfhygkhhagyvnklnslikgtpmesctieel
    ilgqtgavfnnaaqiwnhtfywnsmgpncggeptgpirkkieekfgsfsafktdfsnlla
    ghfgsgwgwlvlkddgtadivqthdagsplkenlgrpllccdvwehayyidykndrlsyi
    nswwnlvnwdfanknleapfkwsx
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k2wA (A:)
    afklpalpygmreliphiseetlsfhygkhhagyvnklnslikgtpmesctieelilgqt
    gavfnnaaqiwnhtfywnsmgpncggeptgpirkkieekfgsfsafktdfsnllaghfgs
    gwgwlvlkddgtadivqthdagsplkenlgrpllccdvwehayyidykndrlsyinswwn
    lvnwdfanknleapfkws
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4k2wB (B:)
    gpgsmafklpalpygmreliphiseetlsfhygkhhagyvnklnslikgtpmesctieel
    ilgqtgavfnnaaqiwnhtfywnsmgpncggeptgpirkkieekfgsfsafktdfsnlla
    ghfgsgwgwlvlkddgtadivqthdagsplkenlgrpllccdvwehayyidykndrlsyi
    nswwnlvnwdfanknleapfkwsx
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k2wB (B:)
    smafklpalpygmreliphiseetlsfhygkhhagyvnklnslikgtpmesctieelilg
    qtgavfnnaaqiwnhtfywnsmgpncggeptgpirkkieekfgsfsafktdfsnllaghf
    gsgwgwlvlkddgtadivqthdagsplkenlgrpllccdvwehayyidykndrlsyinsw
    wnlvnwdfanknleapfkws