PDB entry 4k2u

View 4k2u on RCSB PDB site
Description: Crystal structure of PfEBA-175 F1 in complex with R218 antibody Fab fragment
Class: immune system
Keywords: DBL domain, Immunoglobulin domain, Antibody fragment, Cell attachment, Immunity, Receptor, Ligand, Extracellular, IMMUNE SYSTEM
Deposited on 2013-04-09, released 2013-06-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-12, with a file datestamp of 2013-06-07.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.206
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Erythrocyte binding antigen 175
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: eba-175, MAL7P1.176
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4k2ua_
  • Chain 'B':
    Compound: Erythrocyte binding antigen 175
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: eba-175, MAL7P1.176
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4k2ub_
  • Chain 'H':
    Compound: antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K2U (0-End)
  • Chain 'I':
    Compound: antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K2U (0-End)
  • Chain 'L':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K2U (Start-233)
    Domains in SCOPe 2.06: d4k2ul1, d4k2ul2
  • Chain 'M':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K2U
    Domains in SCOPe 2.06: d4k2um1, d4k2um2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k2uA (A:)
    grntssnnevlsncrekrkgmkwdckkkndrsnyvcipdrriqlcivnlsiiktytketm
    kdhfieaskkesqlllkkndnkynskfcndlknsfldyghlamgndmdfggystkaenki
    qevfkgahgeisehkiknfrkkwwnefreklweamlsehknninncknipqeelqitqwi
    kewhgefllerdnrsklpkskcknntlyeacekecidpcmkyrdwiirskfewhtlskey
    etqkvpkenaenylikisenkndakvslllnncdaeyskycdckhtttlvksvlngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k2uA (A:)
    vlsncrekrkgmkwdckkkndnyvcipdrriqlcivnlsiiktytketmkdhfieaskke
    sqlllkkndnkynskfcndlknsfldyghlamgndmdfggystkaenkiqevfkgahhki
    knfrkkwwnefreklweamlsehknninncknipqeelqitqwikewhgefllerdnrsk
    lkecidpcmkyrdwiirskfewhtlskeyetqkkvslllnncdaeyskyc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4k2uB (B:)
    grntssnnevlsncrekrkgmkwdckkkndrsnyvcipdrriqlcivnlsiiktytketm
    kdhfieaskkesqlllkkndnkynskfcndlknsfldyghlamgndmdfggystkaenki
    qevfkgahgeisehkiknfrkkwwnefreklweamlsehknninncknipqeelqitqwi
    kewhgefllerdnrsklpkskcknntlyeacekecidpcmkyrdwiirskfewhtlskey
    etqkvpkenaenylikisenkndakvslllnncdaeyskycdckhtttlvksvlngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k2uB (B:)
    evlsncrekrkgmkwdckkknyvcipdrriqlcivnlsiiktytketmkdhfieaskkes
    qlllkkndnkynskfcndlknsfldyghlamgndmdfgystkaenkiqevfkisehkikn
    frkkwwnefreklweamlsehknninncknipqeelqitqwikewhgefllerdnrsklp
    kskcklyeacekcidpcmkyrdwiirskfewhtlskeyetqkvpkenaenylikisdakv
    slllnncdaeyskycdc
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4k2uL (L:)
    lsldmmssaqflgllllcfqgtrcdiqmtqttsslsaslgdrvtitcragqdisnylnwy
    qqkpdgtvklliyytsrlhsgvpsrfsgsgsgtdysltisnleqediatyfcqqgstfpw
    tfgggtkleikradaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserq
    ngvlnswtdqdskdstysmsstltltkdeyerhnsytceathkkgefqhtggry
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k2uL (L:)
    diqmtqttsslsaslgdrvtitcragqdisnylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgstfpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyhnsytceathkkgefqhtggry
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4k2uM (M:)
    lsldmmssaqflgllllcfqgtrcdiqmtqttsslsaslgdrvtitcragqdisnylnwy
    qqkpdgtvklliyytsrlhsgvpsrfsgsgsgtdysltisnleqediatyfcqqgstfpw
    tfgggtkleikradaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserq
    ngvlnswtdqdskdstysmsstltltkdeyerhnsytceathkkgefqhtggry
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k2uM (M:)
    diqmtqttsslsaslgdrvtitcragqdisnylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgstfpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathkk