PDB entry 4k2a

View 4k2a on RCSB PDB site
Description: Crystal structure of haloalkane dehalogenase DbeA from Bradyrhizobium elkani USDA94
Class: hydrolase
Keywords: Structural Genomics, Enzyme Function Initiative, Structure 2 Function Project, S2F, two domain organization, dimer catalytic pentad, hydrolase, halogen binding,
Deposited on 2013-04-08, released 2014-06-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.151
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haloalkane dehalogenase
    Species: Bradyrhizobium elkanii [TaxId:29448]
    Gene: dbeA, dhaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4k2aa_
  • Chain 'B':
    Compound: haloalkane dehalogenase
    Species: Bradyrhizobium elkanii [TaxId:29448]
    Gene: dbeA, dhaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4k2ab_
  • Chain 'C':
    Compound: haloalkane dehalogenase
    Species: Bradyrhizobium elkanii [TaxId:29448]
    Gene: dbeA, dhaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot E2RV62 (Start-297)
      • expression tag (298-299)
    Domains in SCOPe 2.06: d4k2ac1, d4k2ac2
  • Chain 'D':
    Compound: haloalkane dehalogenase
    Species: Bradyrhizobium elkanii [TaxId:29448]
    Gene: dbeA, dhaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4k2ad_
  • Heterogens: CL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k2aA (A:)
    adislhhravlgstmayretgrsdaphvlflhgnptssyiwrnimplvapvghciapdli
    gygqsgkpdisyrffdqadyldalidelgiasaylvaqdwgtalafhlaarrpqlvrgla
    fmefirpmrdwsdfhqhdaaretfrkfrtpgvgeamildnnafvervlpgsilrtlseee
    maayrapfatresrmptlmlprelpiagepadvtqaltaahaalaastypkllfvgspga
    lvspafaaefaktlkhcaviqlgagghylqedhpeaigrsvagwiagieaasaqrhaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k2aA (A:)
    dislhhravlgstmayretgrsdaphvlflhgnptssyiwrnimplvapvghciapdlig
    ygqsgkpdisyrffdqadyldalidelgiasaylvaqdwgtalafhlaarrpqlvrglaf
    mefirpmrdwsdfhqhdaaretfrkfrtpgvgeamildnnafvervlpgsilrtlseeem
    aayrapfatresrmptlmlprelpiagepadvtqaltaahaalaastypkllfvgspgal
    vspafaaefaktlkhcaviqlgagghylqedhpeaigrsvagwiagieaasaqrha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4k2aB (B:)
    adislhhravlgstmayretgrsdaphvlflhgnptssyiwrnimplvapvghciapdli
    gygqsgkpdisyrffdqadyldalidelgiasaylvaqdwgtalafhlaarrpqlvrgla
    fmefirpmrdwsdfhqhdaaretfrkfrtpgvgeamildnnafvervlpgsilrtlseee
    maayrapfatresrmptlmlprelpiagepadvtqaltaahaalaastypkllfvgspga
    lvspafaaefaktlkhcaviqlgagghylqedhpeaigrsvagwiagieaasaqrhaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k2aB (B:)
    dislhhravlgstmayretgrsdaphvlflhgnptssyiwrnimplvapvghciapdlig
    ygqsgkpdisyrffdqadyldalidelgiasaylvaqdwgtalafhlaarrpqlvrglaf
    mefirpmrdwsdfhqhdaaretfrkfrtpgvgeamildnnafvervlpgsilrtlseeem
    aayrapfatresrmptlmlprelpiagepadvtqaltaahaalaastypkllfvgspgal
    vspafaaefaktlkhcaviqlgagghylqedhpeaigrsvagwiagieaas
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4k2aC (C:)
    adislhhravlgstmayretgrsdaphvlflhgnptssyiwrnimplvapvghciapdli
    gygqsgkpdisyrffdqadyldalidelgiasaylvaqdwgtalafhlaarrpqlvrgla
    fmefirpmrdwsdfhqhdaaretfrkfrtpgvgeamildnnafvervlpgsilrtlseee
    maayrapfatresrmptlmlprelpiagepadvtqaltaahaalaastypkllfvgspga
    lvspafaaefaktlkhcaviqlgagghylqedhpeaigrsvagwiagieaasaqrhaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k2aC (C:)
    dislhhravlgstmayretgrsdaphvlflhgnptssyiwrnimplvapvghciapdlig
    ygqsgkpdisyrffdqadyldalidelgiasaylvaqdwgtalafhlaarrpqlvrglaf
    mefirpmrdwsdfhqhdaaretfrkfrtpgvgeamildnnafvervlpgsilrtlseeem
    aayrapfatresrmptlmlprelpiagepadvtqaltaahaalaastypkllfvgspgal
    vspafaaefaktlkhcaviqlgagghylqedhpeaigrsvagwiagieaasaqrhaale
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4k2aD (D:)
    adislhhravlgstmayretgrsdaphvlflhgnptssyiwrnimplvapvghciapdli
    gygqsgkpdisyrffdqadyldalidelgiasaylvaqdwgtalafhlaarrpqlvrgla
    fmefirpmrdwsdfhqhdaaretfrkfrtpgvgeamildnnafvervlpgsilrtlseee
    maayrapfatresrmptlmlprelpiagepadvtqaltaahaalaastypkllfvgspga
    lvspafaaefaktlkhcaviqlgagghylqedhpeaigrsvagwiagieaasaqrhaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k2aD (D:)
    dislhhravlgstmayretgrsdaphvlflhgnptssyiwrnimplvapvghciapdlig
    ygqsgkpdisyrffdqadyldalidelgiasaylvaqdwgtalafhlaarrpqlvrglaf
    mefirpmrdwsdfhqhdaaretfrkfrtpgvgeamildnnafvervlpgsilrtlseeem
    aayrapfatresrmptlmlprelpiagepadvtqaltaahaalaastypkllfvgspgal
    vspafaaefaktlkhcaviqlgagghylqedhpeaigrsvagwiagieaasa