PDB entry 4k23

View 4k23 on RCSB PDB site
Description: Structure of anti-uPAR Fab ATN-658
Class: immune system
Keywords: immune system
Deposited on 2013-04-08, released 2014-02-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.201
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: anti-uPAR antibody, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K23 (0-End)
  • Chain 'L':
    Compound: anti-uPAR antibody, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K23 (0-End)
    Domains in SCOPe 2.06: d4k23l1, d4k23l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4k23L (L:)
    dvvmtqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k23L (L:)
    dvvmtqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne