PDB entry 4k21

View 4k21 on RCSB PDB site
Description: Crystal structure of Canavalia boliviana lectin in complex with Xman
Class: Mannose Binding Protein
Keywords: Diocleinae lectins, Dimannosides, Oligomerization, Binding Sites, Jelly roll, Carbohydrate binding, Mannose Binding Protein
Deposited on 2013-04-07, released 2014-04-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Canavalia boliviana lectin
  Species: Canavalia boliviana [TaxId:232300]
  Database cross-references and differences (RAF-indexed):
  • PDB 4K21 (0-236)
  Domains in SCOPe 2.08: d4k21a_
• Heterogens: MN, CA, XMM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4k21A (A:)
  adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
  lsavvsypngdsatvsydvdldnvlpewvrvglsattglyketntilswsftsklksnst
  hetnalhfmfnqfskdqkdlilqgdattgrdgnleltrvssngspqgssvgralfyapvh
  iwessavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan