PDB entry 4k11

View 4k11 on RCSB PDB site
Description: The structure of 1NA in complex with Src T338G
Class: transferase
Keywords: 1NA, c-Src, Kinase, Phosphorylation, TRANSFERASE
Deposited on 2013-04-04, released 2014-04-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC, SRC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12931 (0-447)
      • engineered mutation (254)
    Domains in SCOPe 2.06: d4k11a1, d4k11a2, d4k11a3
  • Heterogens: 0J9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4k11A (A:)
    ttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsdsi
    qaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhyk
    irkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcptskpqtqglakdaweip
    reslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrheklv
    qlyavvseepiyivgeymskgslldflkgetgkylrlpqlvdmaaqiasgmayvermnyv
    hrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygrftiks
    dvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkep
    eerptfeylqafledyftstepqyqpge