PDB entry 4k10

View 4k10 on RCSB PDB site
Description: Crystal Structure of Leshmaniasis major Farnesyl diphosphate synthase in complex with 3-FLUORO-1-(2-HYDROXY-2,2-DIPHOSPHONOETHYL)PYRIDINIUM and Mg2+
Class: transferase/transferase inhibitor
Keywords: Geranyl Transferase, FPPS, farnesyl pyrophosphate synthase, farnesyl diphosphate synthase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-04-04, released 2014-04-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.235
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl pyrophosphate synthase
    Species: Leishmania major [TaxId:5664]
    Gene: FPPS, LMJF_22_1360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4k10a_
  • Chain 'B':
    Compound: farnesyl pyrophosphate synthase
    Species: Leishmania major [TaxId:5664]
    Gene: FPPS, LMJF_22_1360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4k10b_
  • Chain 'C':
    Compound: farnesyl pyrophosphate synthase
    Species: Leishmania major [TaxId:5664]
    Gene: FPPS, LMJF_22_1360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4k10c_
  • Chain 'D':
    Compound: farnesyl pyrophosphate synthase
    Species: Leishmania major [TaxId:5664]
    Gene: FPPS, LMJF_22_1360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4k10d_
  • Heterogens: NA, MG, NI9, PEG, ACT, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k10A (A:)
    mahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvae
    amakdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvt
    aqvaindglillawatqmalhyfadrpflaevlrvfhdvdltttigqlydvtsmvdsakl
    dakvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvam
    vmgeyfqvqddvmdcftppeklgkigtdiedakcswlavtflttapaekvaefkanygst
    dpaavavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwsktykr
    qk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k10A (A:)
    mahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvae
    amakdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvt
    aqvaindglillawatqmalhyfadrpflaevlrvfhdvdltttigqlydvtsmvdsakl
    dakvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvam
    vmgeyfqvqddvmdcftppekigtdiedakcswlavtflttapaekvaefkanygstdpa
    avavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwsktykrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4k10B (B:)
    mahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvae
    amakdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvt
    aqvaindglillawatqmalhyfadrpflaevlrvfhdvdltttigqlydvtsmvdsakl
    dakvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvam
    vmgeyfqvqddvmdcftppeklgkigtdiedakcswlavtflttapaekvaefkanygst
    dpaavavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwsktykr
    qk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k10B (B:)
    mahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvae
    amakdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvt
    aqvaindglillawatqmalhyfadrpflaevlrvfhdvdltttigqlydvtsmvdsakl
    dakvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvam
    vmgeyfqvqddvmdcftppeklgkigtdiedakcswlavtflttapaekvaefkanygst
    dpaavavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwskty
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4k10C (C:)
    mahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvae
    amakdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvt
    aqvaindglillawatqmalhyfadrpflaevlrvfhdvdltttigqlydvtsmvdsakl
    dakvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvam
    vmgeyfqvqddvmdcftppeklgkigtdiedakcswlavtflttapaekvaefkanygst
    dpaavavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwsktykr
    qk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k10C (C:)
    mahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvae
    amakdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvt
    aqvaindglillawatqmalhyfadrpflaevlrvfhdvdltttigqlydvtsmvdsakl
    dakvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvam
    vmgeyfqvqddvmdcftppekgkigtdiedakcswlavtflttapaekvaefkanygstd
    paavavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwsktykrq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4k10D (D:)
    mahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvae
    amakdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvt
    aqvaindglillawatqmalhyfadrpflaevlrvfhdvdltttigqlydvtsmvdsakl
    dakvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvam
    vmgeyfqvqddvmdcftppeklgkigtdiedakcswlavtflttapaekvaefkanygst
    dpaavavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwsktykr
    qk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k10D (D:)
    mahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvae
    amakdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvt
    aqvaindglillawatqmalhyfadrpflaevlrvfhdvdltttigqlydvtsmvdsakl
    dakvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvam
    vmgeyfqvqddvmdcftppeklgkigtdiedakcswlavtflttapaekvaefkanygst
    dpaavavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwsktykr