PDB entry 4k07

View 4k07 on RCSB PDB site
Description: Crystal structure of the amyloid-forming immunoglobulin AL-103 cis-proline 95 mutant
Class: immune system
Keywords: immunoglobulin variable domain, amyloid protein, patient-derived sequence, IMMUNE SYSTEM
Deposited on 2013-04-03, released 2013-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 2.83 Å
R-factor: 0.203
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-103
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K07 (Start-128)
    Domains in SCOPe 2.07: d4k07a_
  • Chain 'B':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-103
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K07 (Start-128)
    Domains in SCOPe 2.07: d4k07b_
  • Chain 'C':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-103
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K07 (Start-128)
    Domains in SCOPe 2.07: d4k07c_
  • Chain 'D':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-103
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K07 (Start-128)
    Domains in SCOPe 2.07: d4k07d_
  • Chain 'E':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-103
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K07 (Start-128)
    Domains in SCOPe 2.07: d4k07e_
  • Chain 'F':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-103
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K07 (Start-128)
    Domains in SCOPe 2.07: d4k07f_
  • Chain 'G':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-103
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K07 (Start-128)
    Domains in SCOPe 2.07: d4k07g_
  • Chain 'H':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-103
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K07 (Start-128)
    Domains in SCOPe 2.07: d4k07h_
  • Chain 'I':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-103
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K07 (Start-128)
    Domains in SCOPe 2.07: d4k07i_
  • Chain 'J':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-103
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K07 (Start-128)
    Domains in SCOPe 2.07: d4k07j_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k07A (A:)
    mrakllgivlttpiaissfastdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqq
    kpgkapklliydasnletgvpsrfsgsgsgtdftftisslqpediatyycqqyhnlpytf
    gpgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k07A (A:)
    tdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqqkpgkapklliydasnletgvp
    srfsgsgsgtdftftisslqpediatyycqqyhnlpytfgpgtkleik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4k07B (B:)
    mrakllgivlttpiaissfastdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqq
    kpgkapklliydasnletgvpsrfsgsgsgtdftftisslqpediatyycqqyhnlpytf
    gpgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k07B (B:)
    tdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqqkpgkapklliydasnletgvp
    srfsgsgsgtdftftisslqpediatyycqqyhnlpytfgpgtkleik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4k07C (C:)
    mrakllgivlttpiaissfastdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqq
    kpgkapklliydasnletgvpsrfsgsgsgtdftftisslqpediatyycqqyhnlpytf
    gpgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k07C (C:)
    tdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqqkpgkapklliydasnletgvp
    srfsgsgsgtdftftisslqpediatyycqqyhnlpytfgpgtkleik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4k07D (D:)
    mrakllgivlttpiaissfastdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqq
    kpgkapklliydasnletgvpsrfsgsgsgtdftftisslqpediatyycqqyhnlpytf
    gpgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k07D (D:)
    tdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqqkpgkapklliydasnletgvp
    srfsgsgsgtdftftisslqpediatyycqqyhnlpytfgpgtkleik
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4k07E (E:)
    mrakllgivlttpiaissfastdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqq
    kpgkapklliydasnletgvpsrfsgsgsgtdftftisslqpediatyycqqyhnlpytf
    gpgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k07E (E:)
    tdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqqkpgkapklliydasnletgvp
    srfsgsgsgtdftftisslqpediatyycqqyhnlpytfgpgtkleik
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4k07F (F:)
    mrakllgivlttpiaissfastdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqq
    kpgkapklliydasnletgvpsrfsgsgsgtdftftisslqpediatyycqqyhnlpytf
    gpgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k07F (F:)
    tdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqqkpgkapklliydasnletgvp
    srfsgsgsgtdftftisslqpediatyycqqyhnlpytfgpgtkleik
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4k07G (G:)
    mrakllgivlttpiaissfastdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqq
    kpgkapklliydasnletgvpsrfsgsgsgtdftftisslqpediatyycqqyhnlpytf
    gpgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k07G (G:)
    tdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqqkpgkapklliydasnletgvp
    srfsgsgsgtdftftisslqpediatyycqqyhnlpytfgpgtkleik
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4k07H (H:)
    mrakllgivlttpiaissfastdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqq
    kpgkapklliydasnletgvpsrfsgsgsgtdftftisslqpediatyycqqyhnlpytf
    gpgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k07H (H:)
    tdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqqkpgkapklliydasnletgvp
    srfsgsgsgtdftftisslqpediatyycqqyhnlpytfgpgtkleik
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4k07I (I:)
    mrakllgivlttpiaissfastdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqq
    kpgkapklliydasnletgvpsrfsgsgsgtdftftisslqpediatyycqqyhnlpytf
    gpgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k07I (I:)
    tdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqqkpgkapklliydasnletgvp
    srfsgsgsgtdftftisslqpediatyycqqyhnlpytfgpgtkleik
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4k07J (J:)
    mrakllgivlttpiaissfastdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqq
    kpgkapklliydasnletgvpsrfsgsgsgtdftftisslqpediatyycqqyhnlpytf
    gpgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k07J (J:)
    tdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqqkpgkapklliydasnletgvp
    srfsgsgsgtdftftisslqpediatyycqqyhnlpytfgpgtkleik