PDB entry 4jzx

View 4jzx on RCSB PDB site
Description: Crystal Structure of Leshmaniasis major Farnesyl diphosphate synthase in complex with 3-BUTYL-1-(2,2-DIPHOSPHONOETHYL)PYRIDINIUM, IPP and Ca2+
Class: transferase/transferase inhibitor
Keywords: Geranyl Transferase, FPPS, farnesyl pyrophosphate synthase, farnesyl diphosphate synthase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-04-03, released 2014-03-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl pyrophosphate synthase
    Species: Leishmania major [TaxId:5664]
    Gene: FPPS, LMJF_22_1360
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4QBL1 (1-361)
      • expression tag (0)
    Domains in SCOPe 2.07: d4jzxa1, d4jzxa2
  • Chain 'B':
    Compound: farnesyl pyrophosphate synthase
    Species: Leishmania major [TaxId:5664]
    Gene: FPPS, LMJF_22_1360
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4QBL1 (1-361)
      • expression tag (0)
    Domains in SCOPe 2.07: d4jzxb1, d4jzxb2
  • Heterogens: IPE, 476, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jzxA (A:)
    mahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvae
    amakdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvt
    aqvaindglillawatqmalhyfadrpflaevlrvfhdvdltttigqlydvtsmvdsakl
    dakvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvam
    vmgeyfqvqddvmdcftppeklgkigtdiedakcswlavtflttapaekvaefkanygst
    dpaavavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwsktykr
    qk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jzxB (B:)
    mahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvae
    amakdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvt
    aqvaindglillawatqmalhyfadrpflaevlrvfhdvdltttigqlydvtsmvdsakl
    dakvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvam
    vmgeyfqvqddvmdcftppeklgkigtdiedakcswlavtflttapaekvaefkanygst
    dpaavavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwsktykr
    qk