PDB entry 4jzb

View 4jzb on RCSB PDB site
Description: Crystal Structure of Leshmaniasis major Farnesyl diphosphate synthase in complex with 1-(2-HYDROXY-2,2-DIPHOSPHONOETHYL)-3-PHENYLPYRIDINIUM, IPP and Ca2+
Class: transferase/transferase inhibitor
Keywords: Geranyl Transferase, FPPS, farnesyl pyrophosphate synthase, farnesyl diphosphate synthase, cytosolic, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-04-02, released 2014-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.175
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl pyrophosphate synthase
    Species: Leishmania major [TaxId:5664]
    Gene: FPPS, LMJF_22_1360
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4QBL1 (1-361)
      • expression tag (0)
    Domains in SCOPe 2.06: d4jzba1, d4jzba2
  • Chain 'B':
    Compound: farnesyl pyrophosphate synthase
    Species: Leishmania major [TaxId:5664]
    Gene: FPPS, LMJF_22_1360
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4QBL1 (1-361)
      • expression tag (0)
    Domains in SCOPe 2.06: d4jzbb1, d4jzbb2
  • Heterogens: CA, IPE, P2H, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jzbA (A:)
    mahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvae
    amakdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvt
    aqvaindglillawatqmalhyfadrpflaevlrvfhdvdltttigqlydvtsmvdsakl
    dakvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvam
    vmgeyfqvqddvmdcftppeklgkigtdiedakcswlavtflttapaekvaefkanygst
    dpaavavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwsktykr
    qk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jzbB (B:)
    mahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvae
    amakdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvt
    aqvaindglillawatqmalhyfadrpflaevlrvfhdvdltttigqlydvtsmvdsakl
    dakvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvam
    vmgeyfqvqddvmdcftppeklgkigtdiedakcswlavtflttapaekvaefkanygst
    dpaavavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwsktykr
    qk