PDB entry 4jz4

View 4jz4 on RCSB PDB site
Description: Crystal structure of chicken c-Src-SH3 domain: monomeric form
Class: signaling protein
Keywords: beta shandwich, SH3 domain, signaling pathways, SIGNALING PROTEIN
Deposited on 2013-04-02, released 2014-04-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.153
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d4jz4a1, d4jz4a2
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d4jz4b1, d4jz4b2
  • Heterogens: NI, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4jz4A (A:)
gshmtfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps
d

    Sequence, based on observed residues (ATOM records): (download) 
    >4jz4A (A:)
gshmtfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4jz4B (B:)
gshmtfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps
d

    Sequence, based on observed residues (ATOM records): (download) 
    >4jz4B (B:)
gshmtfvalydyesrtetdlsfkkgerlqivnngdwwlahslttgqtgyipsnyvaps