PDB entry 4jyy

View 4jyy on RCSB PDB site
Description: Crystal structure of the azide and iron substituted Clostrium difficile SOD2 complex
Class: oxidoreductase
Keywords: Rossmann Fold, superoxide dismutase, METAL ION Binding, cytosol, OXIDOREDUCTASE
Deposited on 2013-04-01, released 2014-04-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.183
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD630_16310, sodA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4jyya1, d4jyya2
  • Heterogens: FE, AZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jyyA (A:)
    pennkfkvkplpyaydalepyidketmklhhdkhyqayvdklnaalekypelynyslcel
    lqnldslpkdiattvrnnaggaynhkfffdimtpektipseslkeaidrdfgsfekfkqe
    fqksaldvfgsgwawlvatkdgklsimttpnqdspvsknltpiigldvwehayylkyqnr
    rneyidnwfnvvnwngalenyknlksqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jyyA (A:)
    nnkfkvkplpyaydalepyidketmklhhdkhyqayvdklnaalekypelynyslcellq
    nldslpkdiattvrnnaggaynhkfffdimtpektipseslkeaidrdfgsfekfkqefq
    ksaldvfgsgwawlvatkdgklsimttpnqdspvsknltpiigldvwehayylkyqnrrn
    eyidnwfnvvnwngalenyknl