PDB entry 4jyp

View 4jyp on RCSB PDB site
Description: crystal Structure of KAI2 Apo form
Class: hydrolase
Keywords: alpha/beta hydrolase, hydrolase
Deposited on 2013-03-31, released 2013-05-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.17
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrolase, alpha/beta fold family protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT4g37470, F6G17.120, kai2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jypa_
  • Chain 'B':
    Compound: Hydrolase, alpha/beta fold family protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT4g37470, F6G17.120, kai2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jypb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jypA (A:)
    mgvveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvddyrvvlydnmgagttnpd
    yfdfdrysnlegysfdliailedlkiescifvghsvsamigvlaslnrpdlfskivmisa
    spryvndvdyqggfeqedlnqlfeairsnykawclgfaplavggdmdsiavqefsrtlfn
    mrpdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpvvvseylhanlgcesvvev
    ipsdghlpqlsspdsvipvilrhirndiam
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jypA (A:)
    gvveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvddyrvvlydnmgagttnpdy
    fdfdrysnlegysfdliailedlkiescifvghsvsamigvlaslnrpdlfskivmisas
    pryvndvdyqggfeqedlnqlfeairsnykawclgfaplavggdmdsiavqefsrtlfnm
    rpdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpvvvseylhanlgcesvvevi
    psdghlpqlsspdsvipvilrhirndi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jypB (B:)
    mgvveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvddyrvvlydnmgagttnpd
    yfdfdrysnlegysfdliailedlkiescifvghsvsamigvlaslnrpdlfskivmisa
    spryvndvdyqggfeqedlnqlfeairsnykawclgfaplavggdmdsiavqefsrtlfn
    mrpdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpvvvseylhanlgcesvvev
    ipsdghlpqlsspdsvipvilrhirndiam
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jypB (B:)
    gvveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvddyrvvlydnmgagttnpdy
    fdfdrysnlegysfdliailedlkiescifvghsvsamigvlaslnrpdlfskivmisas
    pryvndvdyqggfeqedlnqlfeairsnykawclgfaplavggdmdsiavqefsrtlfnm
    rpdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpvvvseylhanlgcesvvevi
    psdghlpqlsspdsvipvilrhirndi