PDB entry 4jy7

View 4jy7 on RCSB PDB site
Description: Crystal structure of Acinetobacter baumannii Peptidyl-tRNA Hydrolase
Class: hydrolase
Keywords: Peptidyl-tRNA hydrolase, enzyme, Molecular Conformation, Inhibition, HYDROLASE
Deposited on 2013-03-29, released 2013-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.161
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-tRNA hydrolase
  Species: Acinetobacter baumannii [TaxId:575584]
  Gene: HMPREF0010_01329, pth
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0C9L6 (0-192)
  Domains in SCOPe 2.07: d4jy7a_
• Heterogens: GOL, EDO, ACT, PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4jy7A (A:)
  msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
  rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
  ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
  pqamnqinaykpa