PDB entry 4jy5

View 4jy5 on RCSB PDB site
Description: Crystal structure of human Fab PGT122, a broadly reactive and potent HIV-1 neutralizing antibody
Class: immune system
Keywords: Broadly neutralizing antibody against HIV-1, HIV-1 Env gp120 subunit, IMMUNE SYSTEM
Deposited on 2013-03-29, released 2013-05-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.2
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: PGT122 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JY5 (0-End)
  • Chain 'L':
    Compound: PGT122 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JY5 (0-End)
    Domains in SCOPe 2.04: d4jy5l1, d4jy5l2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4jy5L (L:)
    tfvsvapgqtaritcgeeslgsrsviwyqqrpgqapsliiynnndrpsgipdrfsgspgs
    tfgttatltitsveagdeadyychiwdsrrptnwvfgegttlivlsqpkaapsvtlfpps
    seelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylslt
    peqwkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jy5L (L:)
    tfvsvapgqtaritcgeeslgsrsviwyqqrpgqapsliiynnndrpsgipdrfsgspgs
    tfgttatltitsveagdeadyychiwdsrrptnwvfgegttlivlsqaapsvtlfppsse
    elqankatlvclisdfypgavtvawkadsspvkagvetttpskyaassylsltpeqwksh
    ksyscqvthegstvektvap