PDB entry 4jxu

View 4jxu on RCSB PDB site
Description: Structure of aminotransferase ilvE2 from Sinorhizobium meliloti complexed with PLP
Class: transferase
Keywords: Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, PFAM Aminotran_4, aminotransferase, TRANSFERASE
Deposited on 2013-03-28, released 2013-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative aminotransferase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: ilvE2, R00971, SMc00042
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jxua_
  • Chain 'B':
    Compound: Putative aminotransferase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: ilvE2, R00971, SMc00042
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jxub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jxuA (A:)
    qsmavdtsprsttwtfvdgewlagnppligptshamwlgstvfdgarwfdgiapdldlhc
    qrvnrsaealglkptmsaeeieglawegvkkfdgktaiyvkpmywgehgswsvvavdpes
    trfalclfeapmgnghagssltlspfrrptlecmptdakagclypnnarilnearsrgfd
    nalvrdmlgniaetgssnifmvkdgvvftpaanrtflagitrsrvmgllseagfeviets
    ltmadfegadeiftsgnyskvlpvtrleqrelqagpvtakardlymdwahatere
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jxuA (A:)
    avdtsprsttwtfvdgewlagnppligptshamwlgstvfdgarwfdgiapdldlhcqrv
    nrsaealglkptmsaeeieglawegvkkfdgktaiyvkpmywgehgswsvvavdpestrf
    alclfeapagssltlspfrrptlecmptdakagclypnnarilnearsrgfdnalvrdml
    gniaetgssnifmvkdgvvftpaanrtflagitrsrvmgllseagfevietsltmadfeg
    adeiftsgnyskvlpvtrleqrelqagpvtakardlymdwaha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jxuB (B:)
    qsmavdtsprsttwtfvdgewlagnppligptshamwlgstvfdgarwfdgiapdldlhc
    qrvnrsaealglkptmsaeeieglawegvkkfdgktaiyvkpmywgehgswsvvavdpes
    trfalclfeapmgnghagssltlspfrrptlecmptdakagclypnnarilnearsrgfd
    nalvrdmlgniaetgssnifmvkdgvvftpaanrtflagitrsrvmgllseagfeviets
    ltmadfegadeiftsgnyskvlpvtrleqrelqagpvtakardlymdwahatere
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jxuB (B:)
    avdtsprsttwtfvdgewlagnppligptshamwlgstvfdgarwfdgiapdldlhcqrv
    nrsaealglkptmsaeeieglawegvkkfdgktaiyvkpmywgehgswsvvavdpestrf
    alclfeassltlspfrrptlecmptdakagclypnnarilnearsrgfdnalvrdmlgni
    aetgssnifmvkdgvvftpaanrtflagitrsrvmgllseagfevietsltmadfegade
    iftsgnyskvlpvtrleqrelqagpvtakardlymdwahate