PDB entry 4jwk

View 4jwk on RCSB PDB site
Description: Crystal structure of the complex of peptidyl-tRNA hydrolase from Acinetobacter baumannii with cytidine at 1.87 A resolution
Class: hydrolase
Keywords: Protein synthesis, complex, HYDROLASE
Deposited on 2013-03-27, released 2013-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.181
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-tRNA hydrolase
  Species: Acinetobacter baumannii ATCC 19606 = CIP 70.34 [TaxId:575584]
  Gene: HMPREF0010_01329, pth
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0C9L6 (0-192)
  Domains in SCOPe 2.07: d4jwka_
• Heterogens: CTN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4jwkA (A:)
  msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
  rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
  ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
  pqamnqinaykpa