PDB entry 4jvw

View 4jvw on RCSB PDB site
Description: IgM C4-domain from mouse
Class: protein binding
Keywords: Immunoglobulin M, antibody, oligomerization, Immunoglobulin fold, Receptor, PROTEIN BINDING
Deposited on 2013-03-26, released 2013-06-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ig mu chain c region secreted form
    Species: Mus musculus [TaxId:10090]
    Gene: Igh-6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jvwa_
  • Chain 'B':
    Compound: ig mu chain c region secreted form
    Species: Mus musculus [TaxId:10090]
    Gene: Igh-6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jvwb_
  • Chain 'C':
    Compound: ig mu chain c region secreted form
    Species: Mus musculus [TaxId:10090]
    Gene: Igh-6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jvwc_
  • Chain 'D':
    Compound: ig mu chain c region secreted form
    Species: Mus musculus [TaxId:10090]
    Gene: Igh-6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jvwd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jvwA (A:)
    mgevhkhppavyllppareqlnlresatvtclvkgfspadisvqwlqrgqllpqekyvts
    apmpepgapgfyfthsiltvteeewnsgetytcvvghealphlvtertvdkstgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jvwA (A:)
    khppavyllppareqlnlresatvtclvkgfspadisvqwlqrgqllpqekyvtsapmpe
    pgapgfyfthsiltvteeewnsgetytcvvghealphlvtertvdkst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jvwB (B:)
    mgevhkhppavyllppareqlnlresatvtclvkgfspadisvqwlqrgqllpqekyvts
    apmpepgapgfyfthsiltvteeewnsgetytcvvghealphlvtertvdkstgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jvwB (B:)
    hkhppavyllppareqlnlresatvtclvkgfspadisvqwlqrgqllpqekyvtsapmp
    epgapgfyfthsiltvteeewnsgetytcvvghealphlvtertvdkst
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4jvwC (C:)
    mgevhkhppavyllppareqlnlresatvtclvkgfspadisvqwlqrgqllpqekyvts
    apmpepgapgfyfthsiltvteeewnsgetytcvvghealphlvtertvdkstgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jvwC (C:)
    khppavyllppareqlnlresatvtclvkgfspadisvqwlqrgqllpqekyvtsapmpe
    pgapgfyfthsiltvteeewnsgetytcvvghealphlvtertvdkst
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4jvwD (D:)
    mgevhkhppavyllppareqlnlresatvtclvkgfspadisvqwlqrgqllpqekyvts
    apmpepgapgfyfthsiltvteeewnsgetytcvvghealphlvtertvdkstgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jvwD (D:)
    hppavyllppareqlnesatvtclvkgfspadisvqwlqrgqllpqekyvtsapmpepga
    pgfyfthsiltvteeewnsgetytcvvghealphlvtertvdkst