PDB entry 4jvu

View 4jvu on RCSB PDB site
Description: IgM C2-domain from mouse
Class: protein binding
Keywords: Immunoglobulin M, antibody, oligomerization, Immunoglobulin fold, Receptor, PROTEIN BINDING
Deposited on 2013-03-26, released 2013-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.139
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig mu chain C region membrane-bound form
    Species: Mus musculus [TaxId:10090]
    Gene: Igh-6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01873 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d4jvua1, d4jvua2
  • Chain 'B':
    Compound: Ig mu chain C region membrane-bound form
    Species: Mus musculus [TaxId:10090]
    Gene: Igh-6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jvub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jvuA (A:)
    mgipavaemnpnvnvfvpprdgfsgpaprkskliceatnftpkpitvswlkdgklvesgf
    ttdpvtienkgstpqtykvistltiseidwlnlnvytcrvdhrgltflknvsstcaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jvuA (A:)
    gipavaemnpnvnvfvpprdgfsgpaprkskliceatnftpkpitvswlkdgklvesgft
    tdpvtietpqtykvistltiseidwlnlnvytcrvdhrgltflknvsstc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jvuB (B:)
    mgipavaemnpnvnvfvpprdgfsgpaprkskliceatnftpkpitvswlkdgklvesgf
    ttdpvtienkgstpqtykvistltiseidwlnlnvytcrvdhrgltflknvsstcaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jvuB (B:)
    emnpnvnvfvpprdgfkskliceatnftpkpitvswlkdgklvesgfttdpvtieqtykv
    istltiseidwlnlnvytcrvdhrgltflknvsstca