PDB entry 4jvs

View 4jvs on RCSB PDB site
Description: Crystal structure of LepB GAP domain from Legionella drancourtii in complex with Rab1-GDP and AlF3
Class: hydrolase activator/protein transport
Keywords: New GAP fold, Bind and hydrolyze guanosine triphosphate, Rab1 Binding, HYDROLASE ACTIVATOR-PROTEIN TRANSPORT complex
Deposited on 2013-03-26, released 2013-05-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: 0.226
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Legionella drancourtii [TaxId:658187]
    Gene: LDG_7216
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ras-related protein Rab-1A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4jvsb_
  • Heterogens: ACY, GDP, AF3, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jvsB (B:)
    sgrpmssmnpeydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtield
    gktiklqiwdtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasen
    vnkllvgnkcdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jvsB (B:)
    eydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwd
    tagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllvgnkc
    dlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm