PDB entry 4jug

View 4jug on RCSB PDB site
Description: Crystal structure of 1918 pandemic influenza virus hemagglutinin mutant D225G
Class: viral protein
Keywords: virus attachment, membrane fusion, VIRAL PROTEIN
Deposited on 2013-03-24, released 2013-05-01
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-05-01, with a file datestamp of 2013-04-26.
No data on structure quality are available

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:59375]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WFX3 (0-321)
      • engineered mutation (221)
      • expression tag (322-323)
    Domains in SCOPe 2.02: d4juga_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:59375]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:59375]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WFX3 (0-321)
      • engineered mutation (221)
      • expression tag (322-323)
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:59375]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:59375]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WFX3 (0-321)
      • engineered mutation (221)
      • expression tag (322-323)
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:59375]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:59375]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WFX3 (0-321)
      • engineered mutation (221)
      • expression tag (322-323)
  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:59375]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:59375]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WFX3 (0-321)
      • engineered mutation (221)
      • expression tag (322-323)
  • Chain 'J':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:59375]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:59375]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WFX3 (0-321)
      • engineered mutation (221)
      • expression tag (322-323)
  • Chain 'L':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:59375]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jugA (A:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
    llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh
    hpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllepgdti
    tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti
    gecpkyvrstklrmatglrnipar
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.