PDB entry 4jre
View 4jre on RCSB PDB site
Description: Crystal structure of nitrate/nitrite exchanger NarK with nitrite bound
Class: TRANSPORT PROTEIN/Immune System
Keywords: Transporter, Immunoglobulin, Major Facilitator Superfamily, Exchanger, TRANSPORT PROTEIN-Immune System complex
Deposited on
2013-03-21, released
2013-05-15
The last revision prior to the SCOPe 2.06 freeze date was dated
2013-07-10, with a file datestamp of
2013-07-05.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.226
AEROSPACI score: 0.24
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Nitrite extrusion protein 1
Species: Escherichia coli [TaxId:83333]
Gene: b1223, JW1214, narK
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Immunoglobulin Gamma-2a, Heavy chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Immunoglobulin Kappa, Light chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d4jrec1, d4jrec2 - Chain 'D':
Compound: Nitrite extrusion protein 1
Species: Escherichia coli [TaxId:83333]
Gene: b1223, JW1214, narK
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: Immunoglobulin Gamma-2a, Heavy chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: Immunoglobulin Kappa, Light chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d4jrel1, d4jrel2 - Heterogens: NO2, GYP, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>4jreC (C:)
dilmtqspsslsvsvgssvtitcqasqnitnyivwyqqkpgqapklliyytstlesgips
rfsgsgsgrdysftisnlqpedvatyyclqynslltfgggtkleikradaaptvsifpps
seqltsggasvvcflnnfypkninvkwkidgserqngvlnswtdqdskdstysmsstltl
tkdeyerhnsytceathktstspivksfnrn
- Chain 'D':
No sequence available.
- Chain 'H':
No sequence available.
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>4jreL (L:)
dilmtqspsslsvsvgssvtitcqasqnitnyivwyqqkpgqapklliyytstlesgips
rfsgsgsgrdysftisnlqpedvatyyclqynslltfgggtkleikradaaptvsifpps
seqltsggasvvcflnnfypkninvkwkidgserqngvlnswtdqdskdstysmsstltl
tkdeyerhnsytceathktstspivksfnrn