PDB entry 4jql

View 4jql on RCSB PDB site
Description: Synthesis of Benzoquinone-Ansamycin-Inspired Macrocyclic Lactams from Shikimic Acid
Class: chaperone/Inhibitor
Keywords: Inhibitor design, Hsp90, nucleotide binding domain, chaperone, Geldanamycin, Cytosole, chaperone-Inhibitor complex
Deposited on 2013-03-20, released 2013-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.169
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jqla_
  • Heterogens: VJ6, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jqlA (A:)
    mgsshhhhhhssglvprgshmdqpmeeeevetfafqaeiaqlmsliintfysnkeiflre
    lisnssdaldkiryesltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnl
    gtiaksgtkafmealqagadismigqfgvgfysaylvaekvtvitkhnddeqyawessag
    gsftvrtdtgepmgrgtkvilhlkedqteyleerrikeivkkhsqfigypitlfvekerd
    kevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jqlA (A:)
    qpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpsk
    ldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadis
    migqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilh
    lkedqteyleerrikeivkkhsqfigypitlfvek