PDB entry 4jpw

View 4jpw on RCSB PDB site
Description: Crystal structure of broadly and potently neutralizing antibody 12a21 in complex with hiv-1 strain 93th057 gp120 mutant
Class: viral protein/immune system
Keywords: hiv, gp120, cd4-binding site, 12a21, neutralization, vaccine, antibody, envelope protein, viral protein-immune system complex
Deposited on 2013-03-19, released 2013-04-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.209
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: hiv-1 clade a/e strain 73th057 gp120 with mutation h375s
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JPW (0-352)
  • Chain 'H':
    Compound: heavy chain of antibody 12a21
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JPW
  • Chain 'L':
    Compound: light chain of antibody 12a21
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JPW (0-End)
    Domains in SCOPe 2.05: d4jpwl1, d4jpwl2
  • Heterogens: NAG, EPE, HOH

PDB Chain Sequences:

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4jpwL (L:)
    diqmtqspsslsasvgdrvtincqagqgigsslnwyqkkpgrapkllvhgasnlqrgvps
    rfsgsgfhttftltisslqpddvatyfcavfqwfgpgtkvdikrtvaapsvfifppsdeq
    lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
    dyekhkvyacevthqglrspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jpwL (L:)
    diqmtqspsslsasvgdrvtincqagqgigsslnwyqkkpgrapkllvhgasnlqrgvps
    rfsgsgfhttftltisslqpddvatyfcavfqwfgpgtkvdikrtvaapsvfifppsdeq
    lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
    dyekhkvyacevthqglrspvtksfnrg