PDB entry 4jpv

View 4jpv on RCSB PDB site
Description: Crystal structure of broadly and potently neutralizing antibody 3bnc117 in complex with hiv-1 gp120
Class: viral protein/immune system
Keywords: hiv, gp120, cd4-binding site, 3bnc117, neutralization, vaccine, antibody, envelope protein, viral protein-immune system complex
Deposited on 2013-03-19, released 2013-04-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 2.83 Å
R-factor: 0.203
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: HIV-1 CLADE A STRAIN 93TH057 GP120 WITH LOOP d AND LOOPD V5 REPLACED FROM HIV STRAIN 3415V1
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JPV (0-351)
  • Chain 'H':
    Compound: heavy chain of antibody 3bnc117
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JPV (0-End)
  • Chain 'L':
    Compound: light chain of antibody 3bnc117
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JPV (0-End)
    Domains in SCOPe 2.04: d4jpvl1, d4jpvl2
  • Heterogens: NAG, EPE, EDO, HOH

PDB Chain Sequences:

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4jpvL (L:)
    diqmtqspsslsasvgdtvtitcqangylnwyqqrrgkapklliydgsklergvpsrfsg
    rrwgqeynltinnlqpediatyfcqvyefvvpgtrldlkrtvaapsvfifppsdeqlksg
    tasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyek
    hkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jpvL (L:)
    diqmtqspsslsasvgdtvtitcqangylnwyqqrrgkapklliydgsklergvpsrfsg
    rrwgqeynltinnlqpediatyfcqvyefvvpgtrldlkrtvaapsvfifppsdeqlksg
    tasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyek
    hkvyacevthqglsspvtksfnrg