PDB entry 4jpk

View 4jpk on RCSB PDB site
Description: Crystal structure of the germline-targeting HIV-1 gp120 engineered outer domain eOD-GT6 in complex with a putative VRC01 germline precursor Fab
Class: immune system/viral protein
Keywords: HIV-1 gp120, CD4 binding, VRC01-like broadly neutralizing antibodies, IMMUNE SYSTEM-VIRAL PROTEIN complex
Deposited on 2013-03-19, released 2013-04-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.203
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Germline-targeting HIV-1 gp120 engineered outer domain, eOD-GT6
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JPK (0-End)
  • Chain 'H':
    Compound: Putative VRC01 germline precursor Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JPK (0-End)
  • Chain 'L':
    Compound: Putative VRC01 germline precursor Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JPK (0-End)
    Domains in SCOPe 2.04: d4jpkl1, d4jpkl2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4jpkL (L:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqyeffgqgtkleikrstvapsvfifppsdeq
    lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
    dyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jpkL (L:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqyeffgqgtkleikrstvapsvfifppsdeq
    lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
    dyekhkvyacevthqglsspvtksfnrg