PDB entry 4jpi

View 4jpi on RCSB PDB site
Description: Crystal structure of a putative VRC01 germline precursor Fab
Class: immune system
Keywords: anti-HIV-1, gp120, CD4 binding site-targeting, VRC01 broadly neutralizing antibody, IMMUNE SYSTEM
Deposited on 2013-03-19, released 2013-04-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.177
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative VRC01 germline Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JPI (0-End)
  • Chain 'B':
    Compound: Putative VRC01 germline Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JPI
    Domains in SCOPe 2.04: d4jpib1, d4jpib2
  • Chain 'H':
    Compound: Putative VRC01 germline Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JPI (0-End)
  • Chain 'L':
    Compound: Putative VRC01 germline Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JPI
    Domains in SCOPe 2.04: d4jpil1, d4jpil2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jpiB (B:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqyeffgqgtkleikrstvapsvfifppsdeq
    lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
    dyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jpiB (B:)
    ivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipar
    fsgsgsgtdftltisslepedfavyycqqyeffgqgtkleikrstvapsvfifppsdeql
    ksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskad
    yekhkvyacevthqglsspvtksfnrg
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4jpiL (L:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqyeffgqgtkleikrstvapsvfifppsdeq
    lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
    dyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jpiL (L:)
    ivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipar
    fsgsgsgtdftltisslepedfavyycqqyeffgqgtkleikrstvapsvfifppsdeql
    ksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskad
    yekhkvyacevthqglsspvtksfnr