PDB entry 4jp2

View 4jp2 on RCSB PDB site
Description: Crystal Structure of TT0495 protein from Thermus thermophilus HB8
Class: oxidoreductase
Keywords: Rossmann fold, OXIDOREDUCTASE
Deposited on 2013-03-19, released 2014-03-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.189
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-deoxy-D-gluconate 3-dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jp2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jp2A (A:)
    merkalvtggsrgigraiaealvargyrvaiasrnpeeaaqslgavplptdlekddpkgl
    vkralealgglhvlvhaaavnvrkpalelsyeewrrvlylhldvafllaqaaaphmaeag
    wgrvlfigsvttftaggpvpipayttaktallgltralakewarlgirvnllcpgyvete
    ftlplrqnpelyepitaripmgrwarpeeiarvaavlcgdeaeyltgqavavdggflay