PDB entry 4jn2

View 4jn2 on RCSB PDB site
Description: An Antidote for Dabigatran
Class: immune system/inhibitor
Keywords: IgG fragment binding dabigatran, dabigatran, immune system-inhibitor complex
Deposited on 2013-03-14, released 2013-03-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.168
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti dabigatran Fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JN2 (0-218)
    Domains in SCOPe 2.03: d4jn2a1, d4jn2a2
  • Chain 'B':
    Compound: anti dabigatran Fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JN2 (Start-224)
  • Chain 'H':
    Compound: anti dabigatran Fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JN2 (0-224)
  • Chain 'L':
    Compound: anti dabigatran Fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JN2 (0-218)
    Domains in SCOPe 2.03: d4jn2l1, d4jn2l2
  • Heterogens: C24, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jn2A (A:)
    dvvmtqsplslpvtlgqpasisckssqsllytdgktylywflqrpgqsprrliylvskld
    sgvpdrfsgsgsgtdftlkisrveaedvgvyyclqsthfphtfgggtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jn2L (L:)
    dvvmtqsplslpvtlgqpasisckssqsllytdgktylywflqrpgqsprrliylvskld
    sgvpdrfsgsgsgtdftlkisrveaedvgvyyclqsthfphtfgggtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec