PDB entry 4jmv

View 4jmv on RCSB PDB site
Description: Crystal structure of Cytochrome C Peroxidase W191G-Gateless in complex with imidazo[1,2-a]pyridin-6-amine
Class: oxidoreductase
Keywords: Model system, bulk solvent, ordered waters, docking, ligand binding, OXIDOREDUCTASE
Deposited on 2013-03-14, released 2013-05-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-05-01, with a file datestamp of 2013-04-26.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.141
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:285006]
    Gene: CCP1 CCP CPO YKR066C, SCRG_04081
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3LRE1 (0-288)
      • engineered mutation (186-187)
    Domains in SCOPe 2.03: d4jmva_
  • Heterogens: HEM, 1LY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jmvA (A:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
    nsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpkyl
    sivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl