PDB entry 4jm4

View 4jm4 on RCSB PDB site
Description: Crystal Structure of PGT 135 Fab
Class: immune system
Keywords: Immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2013-03-13, released 2013-05-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.209
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: PGT 135 Heavy Chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 4JM4 (0-End)
• Chain 'L':
  Compound: PGT 135 Light Chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 4JM4 (0-213)
  Domains in SCOPe 2.05: d4jm4l1, d4jm4l2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4jm4L (L:)
  eivmtqspdtlsvspgetvtlscrasqninknlawyqykpgqsprlvifetyskiaafpa
  rfvasgsgteftltinnmqsedvavyycqqyeewprtfgqgtkvdikrtvaapsvfifpp
  sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
  lskadyekhkvyacevthqglsspvtksfnrgec