PDB entry 4jm4

View 4jm4 on RCSB PDB site
Description: Crystal Structure of PGT 135 Fab
Class: immune system
Keywords: Immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2013-03-13, released 2013-05-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.209
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: PGT 135 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JM4 (0-End)
  • Chain 'L':
    Compound: PGT 135 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JM4 (0-213)
    Domains in SCOPe 2.04: d4jm4l1, d4jm4l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jm4L (L:)
    eivmtqspdtlsvspgetvtlscrasqninknlawyqykpgqsprlvifetyskiaafpa
    rfvasgsgteftltinnmqsedvavyycqqyeewprtfgqgtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec