PDB entry 4jkl

View 4jkl on RCSB PDB site
Description: Crystal Structure of Streptococcus agalactiae beta-glucuronidase in space group P21212
Class: hydrolase
Keywords: alpha/beta barrel, beta-sandwich, sugar-binding domain, glycosyl hydrolase, hydrolase
Deposited on 2013-03-09, released 2014-09-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucuronidase
    Species: Streptococcus agalactiae [TaxId:208435]
    Gene: SAG0698
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8E0N2 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d4jkla1, d4jkla2, d4jkla3, d4jkla4
  • Chain 'B':
    Compound: beta-glucuronidase
    Species: Streptococcus agalactiae [TaxId:208435]
    Gene: SAG0698
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8E0N2 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d4jklb1, d4jklb2, d4jklb3, d4jklb4
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jklA (A:)
    snamlyplltktrntydlggiwnfklgehnpnellpsdevmviptsfndlmvskekrdyi
    gdfwyekvievpkvsedeemvlrfgsvthqakiyvdgvlvgehkggftpfevlvpeckyn
    nekikvsicannvldyttlpvgnyseiiqedgsikkkvrenfdffnyagvhrplklmirp
    knhifdititsrlsddlqsadlhflvetnqkvdevrisvfdednklvgetkdsrlflsdv
    hlwevlnaylytarveifvdnqlqdvyeenfglreievtngqfllnrkpiyfkgfgkhed
    tfingrglneaanlmdlnllkdmgansfrtshypyseemmrladrmgvlvidevpavglf
    qnfnasldlspkdngtwnlmqtkaaheqaiqelvkrdknhpsvvmwvvanepasheagah
    dyfeplvklykdldpqkrpvtlvnilmatpdrdqvmdlvdvvclnryygwyvdhgdltna
    evgirkellewqdkfpdkpiiiteygadtlpglhstwnipyteefqcdfyemshrvfdgi
    pnlvgeqvwnfadfetnlmilrvqgnhkglfsrnrqpkqvvkefkkrwmtiphyhnkkns
    vk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jklA (A:)
    namlyplltktrntydlggiwnfklgehnpnellpsdevmviptsfndlmvskekrdyig
    dfwyekvievpkvsedeemvlrfgsvthqakiyvdgvlvgehkggftpfevlvpeckynn
    ekikvsicannvldyttlpvgnyseiiqedgsikkkvrenfdffnyagvhrplklmirpk
    nhifdititsrlsddlqsadlhflvetnqkvdevrisvfdednklvgetkdsrlflsdvh
    lwevlnaylytarveifvdnqlqdvyeenfglreievtngqfllnrkpiyfkgfgkhedt
    fingrglneaanlmdlnllkdmgansfrtshypyseemmrladrmgvlvidevpavglfq
    nngtwnlmqtkaaheqaiqelvkrdknhpsvvmwvvanepasheagahdyfeplvklykd
    ldpqkrpvtlvnilmatpdrdqvmdlvdvvclnryygwyvdhgdltnaevgirkellewq
    dkfpdkpiiiteygadtlpglhstwnipyteefqcdfyemshrvfdgipnlvgeqvwnfa
    dfetnlmilrvqgnhkglfsrnrqpkqvvkefkkrwmtiphyhnkkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jklB (B:)
    snamlyplltktrntydlggiwnfklgehnpnellpsdevmviptsfndlmvskekrdyi
    gdfwyekvievpkvsedeemvlrfgsvthqakiyvdgvlvgehkggftpfevlvpeckyn
    nekikvsicannvldyttlpvgnyseiiqedgsikkkvrenfdffnyagvhrplklmirp
    knhifdititsrlsddlqsadlhflvetnqkvdevrisvfdednklvgetkdsrlflsdv
    hlwevlnaylytarveifvdnqlqdvyeenfglreievtngqfllnrkpiyfkgfgkhed
    tfingrglneaanlmdlnllkdmgansfrtshypyseemmrladrmgvlvidevpavglf
    qnfnasldlspkdngtwnlmqtkaaheqaiqelvkrdknhpsvvmwvvanepasheagah
    dyfeplvklykdldpqkrpvtlvnilmatpdrdqvmdlvdvvclnryygwyvdhgdltna
    evgirkellewqdkfpdkpiiiteygadtlpglhstwnipyteefqcdfyemshrvfdgi
    pnlvgeqvwnfadfetnlmilrvqgnhkglfsrnrqpkqvvkefkkrwmtiphyhnkkns
    vk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jklB (B:)
    namlyplltktrntydlggiwnfklgehnpnellpsdevmviptsfndlmvskekrdyig
    dfwyekvievpkvsedeemvlrfgsvthqakiyvdgvlvgehkggftpfevlvpeckynn
    ekikvsicannvldyttlpvgnyseiiqedgsikkkvrenfdffnyagvhrplklmirpk
    nhifdititsrlsddlqsadlhflvetnqkvdevrisvfdednklvgetkdsrlflsdvh
    lwevlnaylytarveifvdnqlqdvyeenfglreievtngqfllnrkpiyfkgfgkhedt
    fingrglneaanlmdlnllkdmgansfrtshypyseemmrladrmgvlvidevpavglfq
    nngtwnlmqtkaaheqaiqelvkrdknhpsvvmwvvanepasheagahdyfeplvklykd
    ldpqkrpvtlvnilmatpdrdqvmdlvdvvclnryygwyvdhgdltnaevgirkellewq
    dkfpdkpiiiteygadtlpglhstwnipyteefqcdfyemshrvfdgipnlvgeqvwnfa
    dfetnlmilrvqgnhkglfsrnrqpkqvvkefkkrwmtiphyhnkkn