PDB entry 4jk4

View 4jk4 on RCSB PDB site
Description: Crystal Structure of Bovine Serum Albumin in complex with 3,5-diiodosalicylic acid
Class: transport protein
Keywords: Bovine Serum Albumin, transport Protein, Helical protein possessing three domains, Transport, Fatty acids, hormones, metabolites and drugs, Plasma
Deposited on 2013-03-09, released 2013-07-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.191
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02769 (Start-582)
      • varaint (189)
    Domains in SCOPe 2.04: d4jk4a1, d4jk4a2, d4jk4a3
  • Chain 'B':
    Compound: serum albumin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02769 (Start-582)
      • varaint (189)
    Domains in SCOPe 2.04: d4jk4b1, d4jk4b2, d4jk4b3
  • Heterogens: DIU, PEG, 1PE, PGE, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jk4A (A:)
    dthkseiahrfkdlgeehfkglvliafsqylqqcpfdehvklvneltefaktcvadesha
    gcekslhtlfgdelckvaslretygdmadccekqepernecflshkddspdlpklkpdpn
    tlcdefkadekkfwgkylyeiarrhpyfyapellyyankyngvfqeccqaedkgacllpk
    ietmrekvltssarqrlrcasiqkfgeralkawsvarlsqkfpkaefvevtklvtdltkv
    hkecchgdllecaddradlakyicdnqdtissklkeccdkpllekshciaevekdaipen
    lppltadfaedkdvcknyqeakdaflgsflyeysrrhpeyavsvllrlakeyeatleecc
    akddphacystvfdklkhlvdepqnlikqncdqfeklgeygfqnalivrytrkvpqvstp
    tlvevsrslgkvgtrcctkpesermpctedylslilnrlcvlhektpvsekvtkcctesl
    vnrrpcfsaltpdetyvpkafdeklftfhadictlpdtekqikkqtalvellkhkpkate
    eqlktvmenfvafvdkccaaddkeacfavegpklvvstqtala
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jk4A (A:)
    thkseiahrfkdlgeehfkglvliafsqylqqcpfdehvklvneltefaktcvadeshag
    cekslhtlfgdelckvaslretygdmadccekqepernecflshkddspdlpklkpdpnt
    lcdefkadekkfwgkylyeiarrhpyfyapellyyankyngvfqeccqaedkgacllpki
    etmrekvltssarqrlrcasiqkfgeralkawsvarlsqkfpkaefvevtklvtdltkvh
    kecchgdllecaddradlakyicdnqdtissklkeccdkpllekshciaevekdaipenl
    ppltadfaedkdvcknyqeakdaflgsflyeysrrhpeyavsvllrlakeyeatleecca
    kddphacystvfdklkhlvdepqnlikqncdqfeklgeygfqnalivrytrkvpqvstpt
    lvevsrslgkvgtrcctkpesermpctedylslilnrlcvlhektpvsekvtkccteslv
    nrrpcfsaltpdetyvpkafdeklftfhadictlpdtekqikkqtalvellkhkpkatee
    qlktvmenfvafvdkccaaddkeacfavegpklvvstqtala
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jk4B (B:)
    dthkseiahrfkdlgeehfkglvliafsqylqqcpfdehvklvneltefaktcvadesha
    gcekslhtlfgdelckvaslretygdmadccekqepernecflshkddspdlpklkpdpn
    tlcdefkadekkfwgkylyeiarrhpyfyapellyyankyngvfqeccqaedkgacllpk
    ietmrekvltssarqrlrcasiqkfgeralkawsvarlsqkfpkaefvevtklvtdltkv
    hkecchgdllecaddradlakyicdnqdtissklkeccdkpllekshciaevekdaipen
    lppltadfaedkdvcknyqeakdaflgsflyeysrrhpeyavsvllrlakeyeatleecc
    akddphacystvfdklkhlvdepqnlikqncdqfeklgeygfqnalivrytrkvpqvstp
    tlvevsrslgkvgtrcctkpesermpctedylslilnrlcvlhektpvsekvtkcctesl
    vnrrpcfsaltpdetyvpkafdeklftfhadictlpdtekqikkqtalvellkhkpkate
    eqlktvmenfvafvdkccaaddkeacfavegpklvvstqtala
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jk4B (B:)
    thkseiahrfkdlgeehfkglvliafsqylqqcpfdehvklvneltefaktcvadeshag
    cekslhtlfgdelckvaslretygdmadccekqepernecflshkddspdlpklkpdpnt
    lcdefkadekkfwgkylyeiarrhpyfyapellyyankyngvfqeccqaedkgacllpki
    etmrekvltssarqrlrcasiqkfgeralkawsvarlsqkfpkaefvevtklvtdltkvh
    kecchgdllecaddradlakyicdnqdtissklkeccdkpllekshciaevekdaipenl
    ppltadfaedkdvcknyqeakdaflgsflyeysrrhpeyavsvllrlakeyeatleecca
    kddphacystvfdklkhlvdepqnlikqncdqfeklgeygfqnalivrytrkvpqvstpt
    lvevsrslgkvgtrcctkpesermpctedylslilnrlcvlhektpvsekvtkccteslv
    nrrpcfsaltpdetyvpkafdeklftfhadictlpdtekqikkqtalvellkhkpkatee
    qlktvmenfvafvdkccaaddkeacfavegpklvvstqtala