PDB entry 4jjj

View 4jjj on RCSB PDB site
Description: The structure of T. fusca GH48 D224N mutant
Class: hydrolase
Keywords: GH48, (a/a)6, cellobiohydrolase, HYDROLASE
Deposited on 2013-03-07, released 2014-07-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-30, with a file datestamp of 2014-07-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.124
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulose 1,4-beta-cellobiosidase
    Species: THERMOBIFIDA FUSCA [TaxId:2021]
    Gene: Tfu_1959
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47NH7 (0-End)
      • engineered mutation (223)
    Domains in SCOPe 2.07: d4jjja_
  • Heterogens: CBI, CBK, CE6, CA, NA, FE, ZN, ACT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jjjA (A:)
    sydqafleqyekikdpasgyfrefngllvpyhsvetmiveapdhghqttseafsyylwle
    ayygrvtgdwkplhdawesmetfiipgtkdqptnsaynpnspatyipeqpnadgypsplm
    nnvpvgqdplaqelsstygtneiygmhwlldvdnvygfgfcgdgtddapayintyqrgar
    esvwetiphpscddfthggpngyldlftddqnyakqwrytnapnadaravqvmfwahewa
    keqgkeneiaglmdkaskmgdylryamfdkyfkkigncvgatscpggqgkdsahyllswy
    yswggsldtssawawrigsssshqgyqnvlaayalsqvpelqpdsptgvqdwatsfdrql
    eflqwlqsaeggiaggatnswkgsydtpptglsqfygmyydwqpvwndppsnnwfgfqvw
    nmervaqlyyvtgdaraeaildkwvpwaiqhtdvdadnggqnfqvpsdlewsgqpdtwtg
    tytgnpnlhvqvvsysqdvgvtaalaktlmyyakrsgdttalataeglldallahrdsig
    iatpeqpswdrlddpwdgseglyvppgwsgtmpngdriepgatflsirsfykndplwpqv
    eahlndpqnvpapiverhrfwaqveiatafaahdelfgagap
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jjjA (A:)
    sydqafleqyekikdpasgyfrefngllvpyhsvetmiveapdhghqttseafsyylwle
    ayygrvtgdwkplhdawesmetfiipgtkdqptnsaynpnspatyipeqpnadgypsplm
    nnvpvgqdplaqelsstygtneiygmhwlldvdnvygfgfcgdgtddapayintyqrgar
    esvwetiphpscddfthggpngyldlftddqnyakqwrytnapnadaravqvmfwahewa
    keqgkeneiaglmdkaskmgdylryamfdkyfkkigncvgatscpggqgkdsahyllswy
    yswggsldsawawrigsssshqgyqnvlaayalsqvpelqpdsptgvqdwatsfdrqlef
    lqwlqsaeggiaggatnswkgsydtpptglsqfygmyydwqpvwndppsnnwfgfqvwnm
    ervaqlyyvtgdaraeaildkwvpwaiqhtdvdadnggqnfqvpsdlewsgqpdtwtgty
    tgnpnlhvqvvsysqdvgvtaalaktlmyyakrsgdttalataeglldallahrdsigia
    tpeqpswdrlddpwdgseglyvppgwsgtmpngdriepgatflsirsfykndplwpqvea
    hlndpqnvpapiverhrfwaqveiatafaahdelfg