PDB entry 4jj5

View 4jj5 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF THE Fab FRAGMENT OF 1C2, A MONOCLONAL ANTIBODY SPECIFIC for POLY-GLUTAMINE
Class: Immune System
Keywords: 1C2, Vlx, Neurodegeneration, Polyglutamine Disease, Amyloid Disease, Immunoglobulin fold, Polyglutamine, Immune System
Deposited on 2013-03-07, released 2013-07-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.241
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1c2 fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JJ5 (0-End)
    Domains in SCOPe 2.06: d4jj5a1, d4jj5a2
  • Chain 'B':
    Compound: 1c2 fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JJ5 (0-220)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jj5A (A:)
    qlvltqsssasfslgasakltctlsrqhstytiewyqqqplkppkfvmelkkdgshstgd
    gipdrfsgsssgahrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtvlgqpks
    tptltvfppsseelkenkatlvclisnfspsgvtvawkangtpitqgvdtsnptkegnkf
    massflhltsdqwrshnsftcqvthegdtvekslspa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jj5A (A:)
    qlvltqsssasfslgasakltctlsrqhstytiewyqqqplkppkfvmelkkdgshstgd
    gipdrfsgsssgahrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtvlkstpt
    ltvfppsseelkenkatlvclisnfspsgvtvawgvdtsnptfmassflhtcqvtheg
    

  • Chain 'B':
    No sequence available.