PDB entry 4jho

View 4jho on RCSB PDB site
Description: Structural analysis and insights into glycon specificity of the rice GH1 Os7BGlu26 beta-D-mannosidase
Class: hydrolase
Keywords: GLYCOSIDE HYDROLASE FAMILY 1, BETA-D-MANNOSIDASE,ORYZA SATIVA, TIM BARREL, Glycoside Hydrolase, HYDROLASE
Deposited on 2013-03-05, released 2013-10-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.178
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-mannosidase/beta-glucosidase
    Species: Oryza sativa Indica Group [TaxId:39946]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5ABY0 (20-End)
      • expression tag (15-19)
    Domains in SCOPe 2.06: d4jhoa1, d4jhoa2
  • Heterogens: EPE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jhoA (A:)
    amaditslykkaesaaapftywlnpeiydagglsrrafpegfvfgtaasayqvegmakqg
    grgpsiwdafiekpgtipnnatadvtvdeyhrykedvnimknmgfdayrfsiswsrifpn
    gtgmvnqegvdyynrlidymvkkgikpyanlyhydlplalheqylgwlspniveafadya
    dfcfqtfgdrvkdwftfneprcvaalgydngfhapgrcsgcdaggnsttepylaahhlil
    shaaavkryrekyqlyqkgrigilldfvwyepfsdsnadraaaqrardfhlgwfldpiih
    grypysmleivkdrmptfsdeesrmvkdsidyvginhytsfymkdpgpwnltptsyqddw
    hvgfayerngvpigaqansywlyivpwginkavtyvketygnptmilsengmdqpgnvsi
    tqgvhdtvriryyrnyitelkkaiddgakvigyfawslldnfewrlgytsrfgivyvdyk
    tlkrypkdsafwfknmlsskkrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jhoA (A:)
    aapftywlnpeiydagglsrrafpegfvfgtaasayqvegmakqggrgpsiwdafiekpg
    tipnnatadvtvdeyhrykedvnimknmgfdayrfsiswsrifpngtgmvnqegvdyynr
    lidymvkkgikpyanlyhydlplalheqylgwlspniveafadyadfcfqtfgdrvkdwf
    tfneprcvaalgydngfhapgrcsgcdaggnsttepylaahhlilshaaavkryrekyql
    yqkgrigilldfvwyepfsdsnadraaaqrardfhlgwfldpiihgrypysmleivkdrm
    ptfsdeesrmvkdsidyvginhytsfymkdpgpwnltptsyqddwhvgfayerngvpiga
    qansywlyivpwginkavtyvketygnptmilsengmdqpgnvsitqgvhdtvriryyrn
    yitelkkaiddgakvigyfawslldnfewrlgytsrfgivyvdyktlkrypkdsafwfkn
    mls