PDB entry 4jha

View 4jha on RCSB PDB site
Description: Crystal Structure of RSV-Neutralizing Human Antibody D25
Class: immune system
Keywords: Immunoglobulin, Ig, IMMUNE SYSTEM
Deposited on 2013-03-04, released 2013-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-12, with a file datestamp of 2013-06-07.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.241
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: D25 antigen-binding fragment heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JHA (0-End)
  • Chain 'L':
    Compound: D25 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JHA (0-End)
    Domains in SCOPe 2.07: d4jhal1, d4jhal2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4jhaL (L:)
    diqmtqspsslsaavgdrvtitcqasqdivnylnwyqqkpgkapklliyvasnletgvps
    rfsgsgsgtdfsltisslqpedvatyycqqydnlpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jhaL (L:)
    diqmtqspsslsaavgdrvtitcqasqdivnylnwyqqkpgkapklliyvasnletgvps
    rfsgsgsgtdfsltisslqpedvatyycqqydnlpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr