PDB entry 4jh8

View 4jh8 on RCSB PDB site
Description: Crystal Structure of FosB from Bacillus cereus with Zinc and L-Cysteine-Fosfomycin Ternary Complex
Class: transferase
Keywords: Bacillithiol-S-Transferase, Transferase
Deposited on 2013-03-04, released 2013-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Metallothiol transferase FosB
  Species: Bacillus cereus [TaxId:222523]
  Gene: fosB, BCE_2111
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q739M9 (0-137)
  Domains in SCOPe 2.08: d4jh8a_
• Chain 'B':
  Compound: Metallothiol transferase FosB
  Species: Bacillus cereus [TaxId:222523]
  Gene: fosB, BCE_2111
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q739M9 (0-137)
  Domains in SCOPe 2.08: d4jh8b_
• Heterogens: ZN, MG, GOL, FCN, CYS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4jh8A (A:)
  mlnginhlcfsvsnledsiefyekvlegellvrgrklayfnicgvwvalneeihiprnei
  yqsythiafsveqkdfesllqrleendvhilkgrerdvrdcesiyfvdpdghkfefhsgt
  lqdrlnyyredkphmtfy
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4jh8B (B:)
  mlnginhlcfsvsnledsiefyekvlegellvrgrklayfnicgvwvalneeihiprnei
  yqsythiafsveqkdfesllqrleendvhilkgrerdvrdcesiyfvdpdghkfefhsgt
  lqdrlnyyredkphmtfy