PDB entry 4jh5

View 4jh5 on RCSB PDB site
Description: Crystal Structure of FosB from Bacillus cereus with Cobalt and Fosfomycin
Class: Transferase
Keywords: Bacillithiol-S-Transferase, Transferase
Deposited on 2013-03-04, released 2013-10-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.172
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallothiol transferase FosB
    Species: Bacillus cereus [TaxId:222523]
    Gene: BCE_2111, fosB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4jh5a_
  • Chain 'B':
    Compound: Metallothiol transferase FosB
    Species: Bacillus cereus [TaxId:222523]
    Gene: BCE_2111, fosB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4jh5b_
  • Heterogens: CO, FCN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4jh5A (A:)
mlnginhlcfsvsnledsiefyekvlegellvrgrklayfnicgvwvalneeihiprnei
yqsythiafsveqkdfesllqrleendvhilkgrerdvrdcesiyfvdpdghkfefhsgt
lqdrlnyyredkphmtfy

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4jh5B (B:)
mlnginhlcfsvsnledsiefyekvlegellvrgrklayfnicgvwvalneeihiprnei
yqsythiafsveqkdfesllqrleendvhilkgrerdvrdcesiyfvdpdghkfefhsgt
lqdrlnyyredkphmtfy