PDB entry 4jgz

View 4jgz on RCSB PDB site
Description: Crystal structure of human coxsackievirus A16 uncoating intermediate (space group I222)
Class: virus
Keywords: virus, hand-foot-and-mouth disease, picornavirus uncoating, pocket factor, icosahedral virus
Deposited on 2013-03-04, released 2013-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.286
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyprotein, capsid protein VP1
    Species: Human coxsackievirus A16 [TaxId:31704]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jgza_
  • Chain 'B':
    Compound: Polyprotein, capsid protein VP2
    Species: Human coxsackievirus A16 [TaxId:31704]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jgzb_
  • Chain 'C':
    Compound: Polyprotein, capsid protein VP3
    Species: Human coxsackievirus A16 [TaxId:31704]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jgzc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jgzA (A:)
    gdpiadmidqtvnnqvnrsltalqvlptaanteasshrlgtgvvpalqaaetgassnasd
    knlietrcvlnhhstqetaignffsraglvsiitmpttgtqntdgyvnwdidlmgyaqlr
    rkcelftymrfdaeftfvvakpngelvpqllqymyvppgapkptsrdsfawqtatnpsvf
    vkmtdppaqvsvpfmspasayqwfydgyptfgehlqandldygqcpnnmmgtfsirtvgi
    eksphsitlrvymrikhvrawiprplrnqpylfktnpnykgndikctstsrdkittl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jgzA (A:)
    nlietrcvlnhhstqetaignffsraglvsiitmpttgtqntdgyvnwdidlmgyaqlrr
    kcelftymrfdaeftfvvakpngelvpqllqymyvppgapkptsrdsfawqtatnpsvfv
    kmtdppaqvsvpfmspasayqwfydgyptdldygqcpnnmmgtfsirtvgieksphsitl
    rvymrikhvrawiprplrnqpylfktnpnykgndikctstsrdkittl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jgzB (B:)
    spsaeacgysdrvaqltignstittqeaaniviaygewpeycpdtdatavdkptrpdvsv
    nrfftldtkswakdskgwywkfpdvltevgvfgqnaqfhylyrsgfcvhvqcnaskfhqg
    allvavlpeyvlgtiaggtgnenshppyattqpgqvgavlthpyvldagiplsqltvcph
    qwinlrtnncatiivpymntvpfdsalnhcnfgllvipvvpldfntgatseipitvtiap
    mcaefaglrqavkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jgzB (B:)
    acgysdrvaqltignstittqeaaniviaygewpeycpdtdatavdkptrpdvsvnrfft
    ldtkswakdskgwywkfpdvltevgvfgqnaqfhylyrsgfcvhvqcnaskfhqgallva
    vlpeyvlgtiaenshppyattqpgqvgavlthpyvldagiplsqltvcphqwinlrtnnc
    atiivpymntvpfdsalnhcnfgllvipvvpldfntgatseipitvtiapmcaefaglr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4jgzC (C:)
    giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt
    nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm
    fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisnthyrah
    aragyfdyyttgiitiwyqtnyvvpigapttayivalaaaqdnftmklckdtedieqtan
    iq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jgzC (C:)
    giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt
    nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm
    fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisnthyray
    fdyyttgiitiwyqtnyvvpigapttayivalaaaqdnftmklckdtedie