PDB entry 4jgm

View 4jgm on RCSB PDB site
Description: Crystal structure of RelB double mutants: Y300F/I335V
Class: transcription
Keywords: intertwined dimer, side-by side dimer, transcription factor, TRANSCRIPTION
Deposited on 2013-03-01, released 2014-01-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.211
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor relb
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04863 (8-109)
      • expression tag (0-7)
      • engineered mutation (31)
      • engineered mutation (66)
    Domains in SCOPe 2.05: d4jgma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4jgmA (A:)
lvprgshmntselricrinkesgpctggeelfllcdkvqkedisvvfstaswegradfsq
advhrqvaivfktppyedleisepvtvnvflqrltdgvcseplpftylpr