PDB entry 4jg4

View 4jg4 on RCSB PDB site
Description: Ligand concentration regulates the pathways of coupled protein folding and binding
Class: hydrolase
Keywords: RNA-Binding, Endonuclease, HYDROLASE
Deposited on 2013-02-28, released 2014-01-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.216
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease P protein component
    Species: Bacillus subtilis [TaxId:1423]
    Gene: rnpA, BSSC8_00790
    Database cross-references and differences (RAF-indexed):
    • Uniprot G4ENZ9
      • conflict (1)
      • engineered mutation (38)
      • engineered mutation (89)
      • engineered mutation (106)
    Domains in SCOPe 2.03: d4jg4a_
  • Heterogens: PPV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4jg4A (A:)
mahlkkrnrlkknedfqkvfkhgtsvanrqfvlytldqaendelrvglsvskkignavmr
nrikrlirqafleekerlkekdyiiiarkaasqltyeetkkslqhlwrksslykksssk

    Sequence, based on observed residues (ATOM records): (download) 
    >4jg4A (A:)
ahlkkrnrlkknedfqkvfkhgtsvanrqfvlytldqaendelrvglsvskkignavmrn
rikrlirqafleekerlkekdyiiiarkaasqltyeetkkslqhlwrksslykk