PDB entry 4jg3

View 4jg3 on RCSB PDB site
Description: Crystal structure of catabolite repression control protein (crc) from Pseudomonas aeruginosa
Class: unknown function
Keywords: AP endonuclease protein family, UNKNOWN FUNCTION
Deposited on 2013-02-28, released 2013-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catabolite repression control protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: crc
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51380 (3-261)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4jg3a1, d4jg3a2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jg3A (A:)
    gpamriisvnvngiqaaaergllswlqaqnadviclqdtrasafdlddpsfqldgyflya
    cdaelpeqggvalysrlqpkavisglgfetadrygrylqadfdkvsiatlllpsgqsgde
    slnqkfkfmddfthylskqrrkrreyiycgslyvahqkmdvknwrecqqmpgflaperaw
    ldevfgnlgyadalrevsregdqfswwpdseqaemlnlgwrfdyqvltpglrrfvrnakl
    prqprfsqhaplivdydwqlsi