PDB entry 4jfy

View 4jfy on RCSB PDB site
Description: Apo structure of phosphotyrosine (pYAb) scaffold
Class: immune system
Keywords: immunoglobulin domain, immune system
Deposited on 2013-02-28, released 2013-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.63 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JFY (0-End)
    Domains in SCOPe 2.07: d4jfya1, d4jfya2
  • Chain 'B':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JFY
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JFY
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JFY (0-End)
    Domains in SCOPe 2.07: d4jfyl1, d4jfyl2
  • Heterogens: PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jfyA (A:)
    divltqspatlslspgeratlscmtstdidddmnwyqqkpgqaprllisegntlrpgvpa
    rfsgsgsgtdftltisslepedfavyyclqsfnvpltfgqgtkveikrtvaapsvfifpp
    sdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jfyA (A:)
    divltqspatlslspgeratlscmtstdidddmnwyqqkpgqaprllisegntlrpgvpa
    rfsgsgsgtdftltisslepedfavyyclqsfnvpltfgqgtkveikrtvaapsvfifpp
    sdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4jfyL (L:)
    divltqspatlslspgeratlscmtstdidddmnwyqqkpgqaprllisegntlrpgvpa
    rfsgsgsgtdftltisslepedfavyyclqsfnvpltfgqgtkveikrtvaapsvfifpp
    sdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jfyL (L:)
    divltqspatlslspgeratlscmtstdidddmnwyqqkpgqaprllisegntlrpgvpa
    rfsgsgsgtdftltisslepedfavyyclqsfnvpltfgqgtkveikrtvaapsvfifpp
    sdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge