PDB entry 4jfx

View 4jfx on RCSB PDB site
Description: Structure of phosphotyrosine (pTyr) scaffold bound to pTyr peptide
Class: immune system
Keywords: immmunoglobulin domain, immune system
Deposited on 2013-02-28, released 2013-09-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.165
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JFX (0-213)
    Domains in SCOPe 2.04: d4jfxa1, d4jfxa2
  • Chain 'B':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JFX (0-End)
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JFX
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JFX (0-213)
    Domains in SCOPe 2.04: d4jfxl1, d4jfxl2
  • Chain 'P':
    Compound: phosphopeptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4JFX (Start-11)
  • Heterogens: PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jfxA (A:)
    divltqspatlslspgeratlscmtstdidddmnwyqqkpgqaprllisegntlrpgvpa
    rfsgsgsgtdftltisslepedfavyyclqsfnvpltfgqgtkveikrtvaapsvfifpp
    sdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jfxL (L:)
    divltqspatlslspgeratlscmtstdidddmnwyqqkpgqaprllisegntlrpgvpa
    rfsgsgsgtdftltisslepedfavyyclqsfnvpltfgqgtkveikrtvaapsvfifpp
    sdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'P':
    No sequence available.